PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00111.110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Trihelix
Protein Properties Length: 952aa    MW: 106534 Da    PI: 7.7438
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00111.110genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix48.13e-15855917163
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykk 63 
                     +W+ +ev++Li++r ++++r++ +k ++ lWee+s+ +   g++rsp qCk+ w +l ++y+ 
  Jcr4S00111.110 855 KWKPEEVKKLIKMRGKLHDRFQVAKGRMILWEEISNSLIIDGINRSPAQCKSLWASLLQKYEH 917
                     7***********************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.8E-2739128IPR001279Metallo-beta-lactamase
SuperFamilySSF562818.33E-6440122IPR001279Metallo-beta-lactamase
SMARTSM008491.2E-1452300IPR001279Metallo-beta-lactamase
PfamPF007537.2E-853248IPR001279Metallo-beta-lactamase
Gene3DG3DSA:3.60.15.101.1E-37169340IPR001279Metallo-beta-lactamase
SuperFamilySSF562818.33E-64175493IPR001279Metallo-beta-lactamase
PfamPF075217.1E-6448477IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
Gene3DG3DSA:1.10.10.601.1E-6848914IPR009057Homeodomain-like
PROSITE profilePS500908.362848912IPR017877Myb-like domain
SMARTSM007170.0053852914IPR001005SANT/Myb domain
PfamPF138373.8E-10854916No hitNo description
CDDcd122039.65E-19854916No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 952 aa     Download sequence    Send to blast
MDTEHHAEDR EEWKELGKSM EDSVQRKMEQ FYEGSDGPPL RIVPIGGLGE IGMNCMLVGN  60
HDRYILIDAG VMFPDYDELG VQKIIPDTTF IKKWRHKIEA VVITHGHEDH IGALPWGWGR  120
MPVFAHISDL IVLLGALQLH IPNGCHVSTL MLDRVIFTCS FCFHSLKVIP ALDSCTPIYA  180
SSFTMELIKK RLKENGIFVP SRLKVFRAKK KFTAGPFEVE PIRVTHSIPD CCGLVLRCAD  240
GTILHTGDWK IDESPLDGKV FDRQTLEELS KEGVTLMMSD STNVLSPGRT ISESVVADSL  300
MRRISEAKGR VITTQFASNI HRLGSVKAAA DLTGRKLVFV GMSLRTYLDA AWKDGKAPID  360
PSTLVKVEDI DAYAPKDLLI VTTGSQAEPR AALNLASYGS SHSLKLNKED IILYSAKVIP  420
GNESRVMKML NRISDIGSTI VMGKNELLHT SGHGYRGELE EVLRIVKPQH FLPIHGELLF  480
LKEHELLGKS TGIRHTTVFL LPVVKRTVCL FVFLHGTRRL PRSLAYGWNR RVLSNGFISL  540
GKENLQLMYS DGDKAFGTST ELCVDERLKI ATDGHYCGQH GNSTASKCRG CPVNCPLSHL  600
EKTVSEILRK MVRKYSSKRP EVIAIAVENP TAVLADEVKT RLSGNSDVGF RISALKKVVD  660
GYPKRNRSSK TQLESNGYMQ LDNTSQQNPE GLLFLSLLLC LSGVKLLVDL LEYSKNAKPR  720
NLGHKQSIAK LCAIAHKDEL QIHTDLNFNF EIIQHFPLSV LDSLIVDDVE VGRVLPDDEM  780
ATSTSSLSDR ISSNSEDQDD FWTSLIASSS PVGTSVPNQE HIKEFKEDGG RNSEDETSEM  840
QNSQPKPSKR LKKNKWKPEE VKKLIKMRGK LHDRFQVAKG RMILWEEISN SLIIDGINRS  900
PAQCKSLWAS LLQKYEHQGF MFIKNQSRYD NSEAAEQMMN HDEQGINLAL YL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0v_B2e-744050019424RIBONUCLEASE J
5a0v_A2e-744050019424RIBONUCLEASE J
5a0t_B2e-744050019424RIBONUCLEASE J
5a0t_A2e-744050019424RIBONUCLEASE J
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1355054e-45AC135505.15 Medicago truncatula chromosome 8 clone mth2-24j8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079861.10.0PREDICTED: uncharacterized protein LOC105640214
TrEMBLA0A067K3X70.0A0A067K3X7_JATCU; Uncharacterized protein
STRINGPOPTR_0015s10570.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein